PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15716A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 431aa    MW: 46681.2 Da    PI: 7.6498
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15716AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box193e-061252440
                   zf-B_box  4 rkCpeHeekelqlfCedCqq.llCedCllee.Hkg..Htvv 40
                               r+C  +e+ ++  +C++C+  +lC +C     H g  H++v
  Oropetium_20150105_15716A 12 RRCGACESAPAAVHCRSCGGvFLCTSCDARPaHAGagHERV 52
                               79****************876********999987889875 PP

2zf-B_box24.46.2e-085297342
                   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                                ++C+ +e  ++   C+ +   lC+ C   +H+       Ht+vp+
  Oropetium_20150105_15716A 52 VWVCEVCELAPAAVTCKADAAVLCAACDADIHEAnplarrHTRVPI 97
                               689*****************************77899999**9997 PP

3CCT70.25.2e-24291334144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Oropetium_20150105_15716A 291 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 334
                                9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0025954IPR000315B-box-type zinc finger
CDDcd000210.002251254No hitNo description
PROSITE profilePS5011910.4665097IPR000315B-box-type zinc finger
PfamPF006436.4E-65197IPR000315B-box-type zinc finger
CDDcd000211.88E-75397No hitNo description
SMARTSM003363.3E-95597IPR000315B-box-type zinc finger
PfamPF062038.3E-18291333IPR010402CCT domain
PROSITE profilePS5101716.896291333IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MELHKYWGVG GRRCGACESA PAAVHCRSCG GVFLCTSCDA RPAHAGAGHE RVWVCEVCEL  60
APAAVTCKAD AAVLCAACDA DIHEANPLAR RHTRVPIAPI GSAAAVESML FGTGEAADDQ  120
KATEEHHNHQ HEHGHGHSLN LNVEAKDMKL DYLFSDLDPY LNVELPRFQH ADSVVPNGVA  180
AVELDFTGGI GGVKQSSYSS YTAATSLAHS GSSSEVGVVP DALCVGGGGH GSFELDFTRP  240
KPHQAYMPAY NTATPPSHSV SQVSSVDAAX XXXXXXXXXX XXXXXXXXEG REARLMRYRE  300
KRKNRRFEKT IRYASRKAYA ETRPRIKGRF AKRTDTDTDA DEASEIAVPT AAAAAASYML  360
DFGYSVVPSF XXXXXXXXXX ISSRSARRGA LLCCLIRHGT RCAERCTLYR SMMYRGRTTS  420
SNPVPCTYSF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2432657e-48AK243265.1 Oryza sativa Japonica Group cDNA, clone: J100049E07, full insert sequence.
GenBankAP0035797e-48AP003579.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0709F06.
GenBankAP0149627e-48AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126147e-48CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankCT8375227e-48CT837522.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI009P15, full insert sequence.
GenBankCU4066137e-48CU406613.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C109H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641209.11e-155PREDICTED: zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0E0LE711e-163A0A0E0LE71_ORYPU; Uncharacterized protein
STRINGLOC_Os06g44450.11e-155(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.15e-40CONSTANS-like 2